SCOPe 2.07: Domain d6nmma1: 6nmm A:2-125

Lineage for d6nmma1 (6nmm A:2-125)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins)
   insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243

6. Protein automated matches [378998] (3 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [378999] (4 PDB entries)

8. Domain d6nmma1: 6nmm A:2-125 [379000]
   Other proteins in same PDB: d6nmma2, d6nmmb2, d6nmmc2, d6nmmd2
   automated match to d1knya2
   protein/DNA complex; complexed with a, mg, nmy, ppv; mutant

Details for d6nmma1

PDB Entry: 6nmm, 2.5 Å

PDB Description: ternary complex structure of the t130k mutant of ant-4 with neomycin, ampcpp and pyrophosphate

PDB Compounds: (A:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6nmma1:

Sequence; same for both SEQRES and ATOM records:

>d6nmma1 d.218.1.1 (A:2-125) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmstee
aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
taks

Timeline for d6nmma1:

• d6nmma1 is new in SCOPe 2.07-stable
  
• d6nmma1 appears in the current release, SCOPe 2.08