Lineage for d1foha4 (1foh A:241-341)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30811Family d.16.1.2: PHBH-like [54378] (2 proteins)
  6. 30846Protein Phenol hydroxylase [54382] (1 species)
  7. 30847Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [54383] (1 PDB entry)
  8. 30848Domain d1foha4: 1foh A:241-341 [37900]
    Other proteins in same PDB: d1foha3, d1foha5, d1fohb3, d1fohb5, d1fohc3, d1fohc5, d1fohd3, d1fohd5

Details for d1foha4

PDB Entry: 1foh (more details), 2.4 Å

PDB Description: phenol hydroxylase from trichosporon cutaneum

SCOP Domain Sequences for d1foha4:

Sequence, based on SEQRES records: (download)

>d1foha4 d.16.1.2 (A:241-341) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum)}
geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekgg
rvdrtkftpevvianakkifhpytfdvqqldwftayhigqr

Sequence, based on observed residues (ATOM records): (download)

>d1foha4 d.16.1.2 (A:241-341) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum)}
geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqftpevvi
anakkifhpytfdvqqldwftayhigqr

SCOP Domain Coordinates for d1foha4:

Click to download the PDB-style file with coordinates for d1foha4.
(The format of our PDB-style files is described here.)

Timeline for d1foha4: