SCOPe 2.08: Domain d6ipuc_: 6ipu C:

Lineage for d6ipuc_ (6ipu C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)

8. Domain d6ipuc_: 6ipu C: [378996]
   Other proteins in same PDB: d6ipua_, d6ipub_, d6ipue_, d6ipuf_
   automated match to d5b31c_
   protein/DNA complex; complexed with cl, mn

Details for d6ipuc_

PDB Entry: 6ipu, 1.99 Å

PDB Description: human nucleosome core particle containing 145 bp of dna

PDB Compounds: (C:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d6ipuc_:

Sequence; same for both SEQRES and ATOM records:

>d6ipuc_ a.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaard
nkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpkk

Timeline for d6ipuc_:

• d6ipuc_ first appeared in SCOPe 2.07