Lineage for d1iuv_2 (1iuv 174-275)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78269Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 78270Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 78281Family d.16.1.2: PHBH-like [54378] (2 proteins)
  6. 78282Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)
  7. 78283Species Pseudomonas aeruginosa [TaxId:287] [54381] (14 PDB entries)
  8. 78297Domain d1iuv_2: 1iuv 174-275 [37899]
    Other proteins in same PDB: d1iuv_1

Details for d1iuv_2

PDB Entry: 1iuv (more details), 2.5 Å

PDB Description: p-hydroxybenzoate hydroxylase complexed with 4-4-hydroxybenzoate at ph 5.0

SCOP Domain Sequences for d1iuv_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iuv_2 d.16.1.2 (174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep

SCOP Domain Coordinates for d1iuv_2:

Click to download the PDB-style file with coordinates for d1iuv_2.
(The format of our PDB-style files is described here.)

Timeline for d1iuv_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iuv_1