SCOP 1.57: Domain d1pxa_2: 1pxa 174-275

Lineage for d1pxa_2 (1pxa 174-275)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)

5. Family d.16.1.2: PHBH-like [54378] (2 proteins)

6. Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [54381] (14 PDB entries)

8. Domain d1pxa_2: 1pxa 174-275 [37897]
   Other proteins in same PDB: d1pxa_1

Details for d1pxa_2

PDB Entry: 1pxa, 2.3 Å

PDB Description: crystal structures of mutant pseudomonas aeruginosa p-hydroxybenzoate hydroxylase: the tyr201phe, tyr385phe, and asn300asp variants

SCOP Domain Sequences for d1pxa_2:

Sequence; same for both SEQRES and ATOM records:

>d1pxa_2 d.16.1.2 (174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep

Timeline for d1pxa_2:

• d1pxa_2 first appeared (with stable ids) in SCOP 1.55
  
• d1pxa_2 appears in SCOP 1.59
  
• d1pxa_2 appears in the current release, SCOPe 2.08, called d1pxaa2