Lineage for d1doea2 (1doe A:174-275)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542330Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2542331Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2542401Family d.16.1.2: PHBH-like [54378] (4 proteins)
  6. 2542410Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)
  7. 2542411Species Pseudomonas aeruginosa [TaxId:287] [54381] (18 PDB entries)
  8. 2542427Domain d1doea2: 1doe A:174-275 [37896]
    Other proteins in same PDB: d1doea1
    complexed with br, dob, fad

Details for d1doea2

PDB Entry: 1doe (more details), 2.3 Å

PDB Description: the mobil flavin of 4-oh benzoate hydroxylase: motion of a prosthetic group regulates catalysis
PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOPe Domain Sequences for d1doea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1doea2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa [TaxId: 287]}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep

SCOPe Domain Coordinates for d1doea2:

Click to download the PDB-style file with coordinates for d1doea2.
(The format of our PDB-style files is described here.)

Timeline for d1doea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1doea1