![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) ![]() |
![]() | Family d.16.1.2: PHBH-like [54378] (2 proteins) |
![]() | Protein p-Hydroxybenzoate hydroxylase, PHBH [54379] (2 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [54381] (14 PDB entries) |
![]() | Domain d1doe_2: 1doe 174-275 [37896] Other proteins in same PDB: d1doe_1 |
PDB Entry: 1doe (more details), 2.3 Å
SCOP Domain Sequences for d1doe_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1doe_2 d.16.1.2 (174-275) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa} lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep
Timeline for d1doe_2: