| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) ![]() |
| Family d.16.1.2: PHBH-like [54378] (2 proteins) |
| Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [54381] (14 PDB entries) |
| Domain d1d7la2: 1d7l A:174-275 [37895] Other proteins in same PDB: d1d7la1 |
PDB Entry: 1d7l (more details), 2.2 Å
SCOP Domain Sequences for d1d7la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7la2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep
Timeline for d1d7la2: