SCOP 1.57: Domain d1d7la2: 1d7l A:174-275

Lineage for d1d7la2 (1d7l A:174-275)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)

5. Family d.16.1.2: PHBH-like [54378] (2 proteins)

6. Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [54381] (14 PDB entries)

8. Domain d1d7la2: 1d7l A:174-275 [37895]
   Other proteins in same PDB: d1d7la1

Details for d1d7la2

PDB Entry: 1d7l, 2.2 Å

PDB Description: structure-function correlations of the reaction of reduced nicotinamide analogs with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins

SCOP Domain Sequences for d1d7la2:

Sequence; same for both SEQRES and ATOM records:

>d1d7la2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep

Timeline for d1d7la2:

• d1d7la2 first appeared (with stable ids) in SCOP 1.55
  
• d1d7la2 appears in SCOP 1.59
  
• d1d7la2 appears in the current release, SCOPe 2.08