Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (67 PDB entries) |
Domain d6k1kf_: 6k1k F: [378935] Other proteins in same PDB: d6k1kc_, d6k1kd_, d6k1kg_, d6k1kh_ automated match to d1kx5b_ protein/DNA complex; complexed with cl, k, mn |
PDB Entry: 6k1k (more details), 2.2 Å
SCOPe Domain Sequences for d6k1kf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k1kf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} lrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktv tamdvvyalkrqgrtlygfgg
Timeline for d6k1kf_: