Lineage for d6ionl2 (6ion L:109-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752959Domain d6ionl2: 6ion L:109-214 [378934]
    Other proteins in same PDB: d6ionh_, d6ionl1
    automated match to d1h3pl2
    complexed with nag

Details for d6ionl2

PDB Entry: 6ion (more details), 2.75 Å

PDB Description: the complex of c4.4a with its antibody 11h10 fab fragment
PDB Compounds: (L:) anti-C4.4A antibody 11H10, light chain

SCOPe Domain Sequences for d6ionl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ionl2 b.1.1.2 (L:109-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d6ionl2:

Click to download the PDB-style file with coordinates for d6ionl2.
(The format of our PDB-style files is described here.)

Timeline for d6ionl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ionl1
View in 3D
Domains from other chains:
(mouse over for more information)
d6ionh_