SCOPe 2.08: Domain d6j3xa2: 6j3x A:358-418

Lineage for d6j3xa2 (6j3x A:358-418)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Pelomonas saccharophila [TaxId:304] [377976] (4 PDB entries)

8. Domain d6j3xa2: 6j3x A:358-418 [378920]
   Other proteins in same PDB: d6j3xa1
   automated match to d1gcya1
   complexed with ca, edo

Details for d6j3xa2

PDB Entry: 6j3x, 1.62 Å

PDB Description: the structure of maltooligosaccharide-forming amylase from pseudomonas saccharophila stb07 with maltotriose

PDB Compounds: (A:) Glucan 1,4-alpha-maltotetraohydrolase

SCOPe Domain Sequences for d6j3xa2:

Sequence; same for both SEQRES and ATOM records:

>d6j3xa2 b.71.1.0 (A:358-418) automated matches {Pelomonas saccharophila [TaxId: 304]}
radsaisfhsgysglvatvsgsqqtlvvalnsdlanpgqvasgsfseavnasngqvrvwr
s

Timeline for d6j3xa2:

• d6j3xa2 first appeared in SCOPe 2.07