Lineage for d6ipuf_ (6ipu F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698556Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries)
  8. 2698576Domain d6ipuf_: 6ipu F: [378910]
    Other proteins in same PDB: d6ipua_, d6ipuc_, d6ipud_, d6ipue_, d6ipug_, d6ipuh_
    automated match to d1aoif_
    protein/DNA complex; complexed with cl, mn

Details for d6ipuf_

PDB Entry: 6ipu (more details), 1.99 Å

PDB Description: human nucleosome core particle containing 145 bp of dna
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d6ipuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ipuf_ a.22.1.1 (F:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
akrktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d6ipuf_:

Click to download the PDB-style file with coordinates for d6ipuf_.
(The format of our PDB-style files is described here.)

Timeline for d6ipuf_: