Lineage for d6tshb4 (6tsh B:626-730)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372435Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2372436Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2372450Species Escherichia coli [TaxId:562] [49306] (45 PDB entries)
    Uniprot P00722
  8. 2372774Domain d6tshb4: 6tsh B:626-730 [378903]
    Other proteins in same PDB: d6tsha1, d6tsha3, d6tsha5, d6tshb1, d6tshb3, d6tshb5, d6tshc1, d6tshc3, d6tshc5, d6tshd1, d6tshd3, d6tshd5
    automated match to d1jz8a2
    complexed with dgj, mg

Details for d6tshb4

PDB Entry: 6tsh (more details), 2.3 Å

PDB Description: beta-galactosidase in complex with deoxygalacto-nojirimycin
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6tshb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tshb4 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d6tshb4:

Click to download the PDB-style file with coordinates for d6tshb4.
(The format of our PDB-style files is described here.)

Timeline for d6tshb4: