Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
Species Escherichia coli [TaxId:562] [49306] (45 PDB entries) Uniprot P00722 |
Domain d6tshb4: 6tsh B:626-730 [378903] Other proteins in same PDB: d6tsha1, d6tsha3, d6tsha5, d6tshb1, d6tshb3, d6tshb5, d6tshc1, d6tshc3, d6tshc5, d6tshd1, d6tshd3, d6tshd5 automated match to d1jz8a2 complexed with dgj, mg |
PDB Entry: 6tsh (more details), 2.3 Å
SCOPe Domain Sequences for d6tshb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tshb4 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d6tshb4:
View in 3D Domains from same chain: (mouse over for more information) d6tshb1, d6tshb2, d6tshb3, d6tshb5 |