Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.2: PHBH-like [54378] (4 proteins) |
Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species) |
Species Pseudomonas aeruginosa [TaxId:287] [54381] (18 PDB entries) |
Domain d1iuua2: 1iuu A:174-275 [37890] Other proteins in same PDB: d1iuua1 complexed with fad, pab |
PDB Entry: 1iuu (more details), 2 Å
SCOPe Domain Sequences for d1iuua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iuua2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa [TaxId: 287]} lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep
Timeline for d1iuua2: