Lineage for d1iuu_2 (1iuu 174-275)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30811Family d.16.1.2: PHBH-like [54378] (2 proteins)
  6. 30812Protein p-Hydroxybenzoate hydroxylase, PHBH [54379] (2 species)
  7. 30813Species Pseudomonas aeruginosa [TaxId:287] [54381] (14 PDB entries)
  8. 30816Domain d1iuu_2: 1iuu 174-275 [37890]
    Other proteins in same PDB: d1iuu_1

Details for d1iuu_2

PDB Entry: 1iuu (more details), 2 Å

PDB Description: p-hydroxybenzoate hydroxylase complexed with 4-aminobenzoate at ph 9.4

SCOP Domain Sequences for d1iuu_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iuu_2 d.16.1.2 (174-275) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep

SCOP Domain Coordinates for d1iuu_2:

Click to download the PDB-style file with coordinates for d1iuu_2.
(The format of our PDB-style files is described here.)

Timeline for d1iuu_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iuu_1