SCOPe 2.08: Domain d6smrd1: 6smr D:1-470

Lineage for d6smrd1 (6smr D:1-470)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein automated matches [190152] (25 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318454] (6 PDB entries)

8. Domain d6smrd1: 6smr D:1-470 [378895]
   Other proteins in same PDB: d6smra2, d6smrb2, d6smrc2, d6smrd2
   automated match to d5v7ia_
   complexed with edo, mtx, pls, trs

Details for d6smrd1

PDB Entry: 6smr, 2.12 Å

PDB Description: a. thaliana serine hydroxymethyltransferase isoform 4 (atshmt4) in complex with methotrexate

PDB Compounds: (D:) Serine hydroxymethyltransferase 4

SCOPe Domain Sequences for d6smrd1:

Sequence; same for both SEQRES and ATOM records:

>d6smrd1 c.67.1.4 (D:1-470) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mepvsswgntslvsvdpeihdliekekrrqcrgieliasenftsfaviealgsaltnkys
egipgnryyggnefideienlcrsraleafhcdpaawgvnvqpysgspanfaaytallqp
hdrimgldlpsgghlthgyytsggkkisatsiyfeslpykvnfttgyidydkleekaldf
rpkllicggsayprdwdyarfraiadkvgalllcdmahisglvaaqeaanpfeycdvvtt
tthkslrgpragmifyrkgpkppkkgqpegavydfedkinfavfpalqggphnhqigala
valkqantpgfkvyakqvkanavalgnylmskgyqivtngtenhlvlwdlrplgltgnkv
eklcdlcsitlnknavfgdssalapggvrigapamtsrglvekdfeqigeflsravtltl
diqktygkllkdfnkglvnnkdldqlkadvekfsasyempgflmsemkyk

Timeline for d6smrd1:

• d6smrd1 first appeared in SCOPe 2.07