Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (3 species) |
Species Escherichia coli [TaxId:562] [49805] (45 PDB entries) Uniprot P00722 |
Domain d6tshd1: 6tsh D:9-219 [378878] Other proteins in same PDB: d6tsha2, d6tsha3, d6tsha4, d6tsha5, d6tshb2, d6tshb3, d6tshb4, d6tshb5, d6tshc2, d6tshc3, d6tshc4, d6tshc5, d6tshd2, d6tshd3, d6tshd4, d6tshd5 automated match to d1f4ha3 complexed with dgj, mg |
PDB Entry: 6tsh (more details), 2.3 Å
SCOPe Domain Sequences for d6tshd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tshd1 b.18.1.5 (D:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d6tshd1:
View in 3D Domains from same chain: (mouse over for more information) d6tshd2, d6tshd3, d6tshd4, d6tshd5 |