Lineage for d6tskb1 (6tsk B:9-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383918Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2383919Protein beta-Galactosidase [49804] (3 species)
  7. 2384140Species Human alphaherpesvirus 1 strain rh2 [TaxId:946522] [378852] (1 PDB entry)
  8. 2384142Domain d6tskb1: 6tsk B:9-219 [378861]
    Other proteins in same PDB: d6tska2, d6tska3, d6tska4, d6tska5, d6tskb2, d6tskb3, d6tskb4, d6tskb5, d6tskc2, d6tskc3, d6tskc4, d6tskc5, d6tskd2, d6tskd3, d6tskd4, d6tskd5
    automated match to d1f4ha3
    complexed with 0mk, mg

Details for d6tskb1

PDB Entry: 6tsk (more details), 2.3 Å

PDB Description: beta-galactosidase in complex with l-ribose
PDB Compounds: (B:) LacZ protein

SCOPe Domain Sequences for d6tskb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tskb1 b.18.1.5 (B:9-219) beta-Galactosidase {Human alphaherpesvirus 1 strain rh2 [TaxId: 946522]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d6tskb1:

Click to download the PDB-style file with coordinates for d6tskb1.
(The format of our PDB-style files is described here.)

Timeline for d6tskb1: