Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [378812] (2 PDB entries) |
Domain d6oarb_: 6oar B: [378816] automated match to d5tl6c_ complexed with aye |
PDB Entry: 6oar (more details), 2.06 Å
SCOPe Domain Sequences for d6oarb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oarb_ d.15.1.0 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]} atlnilvrndkgrsssyevqltqtvavlkqqvcqrervqadqfwlsfegkpmddehplge yglttgctvfmnlrlrg
Timeline for d6oarb_: