Lineage for d6oarb_ (6oar B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933575Species Sheep (Ovis aries) [TaxId:9940] [378812] (2 PDB entries)
  8. 2933576Domain d6oarb_: 6oar B: [378816]
    automated match to d5tl6c_
    complexed with aye

Details for d6oarb_

PDB Entry: 6oar (more details), 2.06 Å

PDB Description: structure of the kupe virus otu bound to the c-terminal domain of sheep isg15
PDB Compounds: (B:) Interferon stimulated gene 17

SCOPe Domain Sequences for d6oarb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oarb_ d.15.1.0 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
atlnilvrndkgrsssyevqltqtvavlkqqvcqrervqadqfwlsfegkpmddehplge
yglttgctvfmnlrlrg

SCOPe Domain Coordinates for d6oarb_:

Click to download the PDB-style file with coordinates for d6oarb_.
(The format of our PDB-style files is described here.)

Timeline for d6oarb_: