SCOP 1.75: Domain d1pbba2: 1pbb A:174-275

Lineage for d1pbba2 (1pbb A:174-275)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.2: PHBH-like [54378] (4 proteins)

6. Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)

7. Species Pseudomonas fluorescens [TaxId:294] [54380] (17 PDB entries)

8. Domain d1pbba2: 1pbb A:174-275 [37879]
   Other proteins in same PDB: d1pbba1
   complexed with dob, fad; mutant

Details for d1pbba2

PDB Entry: 1pbb, 2.5 Å

PDB Description: crystal structures of wild-type p-hydroxybenzoate hydroxylase complexed with 4-aminobenzoate, 2,4-dihydroxybenzoate and 2-hydroxy- 4-aminobenzoate and of the try222ala mutant, complexed with 2- hydroxy-4-aminobenzoate. evidence for a proton channel and a new binding mode of the flavin ring

PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOP Domain Sequences for d1pbba2:

Sequence; same for both SEQRES and ATOM records:

>d1pbba2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas fluorescens [TaxId: 294]}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekved
wsderfwtelkarlpaevaeklvtgpsleksiaplrsfvvep

Timeline for d1pbba2:

• d1pbba2 first appeared (with stable ids) in SCOP 1.55, called d1pbb_2
  
• d1pbba2 appears in SCOP 1.73
  
• d1pbba2 appears in SCOPe 2.01
  
• d1pbba2 appears in the current release, SCOPe 2.08