SCOPe 2.08: Domain d1cj3a2: 1cj3 A:174-275

Lineage for d1cj3a2 (1cj3 A:174-275)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.2: PHBH-like [54378] (4 proteins)

6. Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)

7. Species Pseudomonas fluorescens [TaxId:294] [54380] (17 PDB entries)

8. Domain d1cj3a2: 1cj3 A:174-275 [37878]
   Other proteins in same PDB: d1cj3a1
   complexed with fad, phb; mutant

Details for d1cj3a2

PDB Entry: 1cj3, 2.5 Å

PDB Description: mutant tyr38glu of para-hydroxybenzoate hydroxylase

PDB Compounds: (A:) protein (p-hydroxybenzoate hydroxylase)

SCOPe Domain Sequences for d1cj3a2:

Sequence; same for both SEQRES and ATOM records:

>d1cj3a2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas fluorescens [TaxId: 294]}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekved
wsderfwtelkarlpaevaeklvtgpsleksiaplrsfvvep

Timeline for d1cj3a2:

• d1cj3a2 first appeared (with stable ids) in SCOP 1.55
  
• d1cj3a2 appears in SCOPe 2.07