Lineage for d6t3ba1 (6t3b A:146-320)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932904Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2932926Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
    includes parts of the flanking linkers
  7. 2932927Species Human (Homo sapiens) [TaxId:9606] [54276] (77 PDB entries)
  8. 2933000Domain d6t3ba1: 6t3b A:146-320 [378758]
    Other proteins in same PDB: d6t3ba2, d6t3ba3
    automated match to d1he8a3
    complexed with m9t

    has additional insertions and/or extensions that are not grouped together

Details for d6t3ba1

PDB Entry: 6t3b (more details), 3.01 Å

PDB Description: crystal structure of pi3kgamma with a dihydropurinone inhibitor (compound 4)
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d6t3ba1:

Sequence, based on SEQRES records: (download)

>d6t3ba1 d.15.1.5 (A:146-320) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
esqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtsk
plpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipesq
seqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrk

Sequence, based on observed residues (ATOM records): (download)

>d6t3ba1 d.15.1.5 (A:146-320) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
esqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtsk
plpeylwkkianncifivihrttsqtikvspddtpgailqdfvlrvcgrdeylvgetpik
nfqwvrhclkngeeihvvldtppdpaldevrk

SCOPe Domain Coordinates for d6t3ba1:

Click to download the PDB-style file with coordinates for d6t3ba1.
(The format of our PDB-style files is described here.)

Timeline for d6t3ba1: