SCOPe 2.08: Domain d6qsma1: 6qsm A:2-218

Lineage for d6qsma1 (6qsm A:2-218)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Clavularia sp. [TaxId:86521] [188532] (9 PDB entries)

8. Domain d6qsma1: 6qsm A:2-218 [378751]
   Other proteins in same PDB: d6qsma2
   automated match to d2btja_
   mutant

Details for d6qsma1

PDB Entry: 6qsm, 1.65 Å

PDB Description: mtfp* open conformation: i197c-y200h-y204h mutant for enhanced metal binding

PDB Compounds: (A:) GFP-like fluorescent chromoprotein cFP484

SCOPe Domain Sequences for d6qsma1:

Sequence; same for both SEQRES and ATOM records:

>d6qsma1 d.22.1.0 (A:2-218) automated matches {Clavularia sp. [TaxId: 86521]}
gvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydilttaf
xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkge
nfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakkav
klpdyhfvdhrieclnhdkdhnkvtvyesavarns

Timeline for d6qsma1:

• d6qsma1 first appeared in SCOPe 2.07