| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Clavularia sp. [TaxId:86521] [188532] (9 PDB entries) |
| Domain d6qsma1: 6qsm A:2-218 [378751] Other proteins in same PDB: d6qsma2 automated match to d2btja_ mutant |
PDB Entry: 6qsm (more details), 1.65 Å
SCOPe Domain Sequences for d6qsma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qsma1 d.22.1.0 (A:2-218) automated matches {Clavularia sp. [TaxId: 86521]}
gvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydilttaf
xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkge
nfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakkav
klpdyhfvdhrieclnhdkdhnkvtvyesavarns
Timeline for d6qsma1: