SCOPe 2.07: Domain d6r89d_: 6r89 D:

Lineage for d6r89d_ (6r89 D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226598] (6 PDB entries)

8. Domain d6r89d_: 6r89 D: [378744]
   automated match to d4la9a_
   complexed with cl, cys, gol, na

Details for d6r89d_

PDB Entry: 6r89, 2.5 Å

PDB Description: structure of arabidopsis thaliana glr3.3 ligand-binding domain in complex with l-cysteine

PDB Compounds: (D:) Glutamate receptor 3.3,Glutamate receptor 3.3

SCOPe Domain Sequences for d6r89d_:

Sequence; same for both SEQRES and ATOM records:

>d6r89d_ c.94.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elkigvplrvsykefvsqirgtenmfkgfcidvftaavnllpyavpvkfipygngkenps
ythmvemittgnfdgvvgdvaivtnrtkivdftqpyaasglvvvapggtpikgieslrer
ddpigyqvgsfaesylrnelnisesrlvplgtpeayakalkdgpskggvaaivderpyve
lflssncayrivgqeftksgwgfafprdsplaidlstailelaengdlqrihdkwlmkna
ct

Timeline for d6r89d_:

• d6r89d_ is new in SCOPe 2.07-stable
  
• d6r89d_ appears in the current release, SCOPe 2.08