Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226598] (6 PDB entries) |
Domain d6r89d_: 6r89 D: [378744] automated match to d4la9a_ complexed with cl, cys, gol, na |
PDB Entry: 6r89 (more details), 2.5 Å
SCOPe Domain Sequences for d6r89d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r89d_ c.94.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} elkigvplrvsykefvsqirgtenmfkgfcidvftaavnllpyavpvkfipygngkenps ythmvemittgnfdgvvgdvaivtnrtkivdftqpyaasglvvvapggtpikgieslrer ddpigyqvgsfaesylrnelnisesrlvplgtpeayakalkdgpskggvaaivderpyve lflssncayrivgqeftksgwgfafprdsplaidlstailelaengdlqrihdkwlmkna ct
Timeline for d6r89d_: