SCOPe 2.05: Domain d1bkwa2: 1bkw A:174-275

Lineage for d1bkwa2 (1bkw A:174-275)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.2: PHBH-like [54378] (4 proteins)

6. Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)

7. Species Pseudomonas fluorescens [TaxId:294] [54380] (17 PDB entries)

8. Domain d1bkwa2: 1bkw A:174-275 [37874]
   Other proteins in same PDB: d1bkwa1
   complexed with fad, phb; mutant

Details for d1bkwa2

PDB Entry: 1bkw, 2.2 Å

PDB Description: p-hydroxybenzoate hydroxylase (phbh) mutant with cys116 replaced by ser (c116s) and arg44 replaced by lys (r44k), in complex with fad and 4-hydroxybenzoic acid

PDB Compounds: (A:) protein (p-hydroxybenzoate hydroxylase)

SCOPe Domain Sequences for d1bkwa2:

Sequence; same for both SEQRES and ATOM records:

>d1bkwa2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas fluorescens [TaxId: 294]}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekved
wsderfwtelkarlpaevaeklvtgpsleksiaplrsfvvep

Timeline for d1bkwa2:

• d1bkwa2 first appeared (with stable ids) in SCOP 1.55
  
• d1bkwa2 appears in SCOPe 2.04
  
• d1bkwa2 appears in SCOPe 2.06
  
• d1bkwa2 appears in the current release, SCOPe 2.08