Lineage for d6jixb_ (6jix B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896826Species Bifidobacterium kashiwanohense [TaxId:1447716] [378713] (1 PDB entry)
  8. 2896828Domain d6jixb_: 6jix B: [378725]
    automated match to d5g09b_
    complexed with ggl, plp

Details for d6jixb_

PDB Entry: 6jix (more details), 2.65 Å

PDB Description: the cyrstal structure of taurine:2-oxoglutarate aminotransferase from bifidobacterium kashiwanohense, in complex with plp and glutamate
PDB Compounds: (B:) taurine:2-oxoglutarate aminotransferase

SCOPe Domain Sequences for d6jixb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jixb_ c.67.1.0 (B:) automated matches {Bifidobacterium kashiwanohense [TaxId: 1447716]}
meeltgeevaslhseyvmqswhkqggpvkpikkadgiyfwdydgkrytdmssllvcsnlg
helpeivdaikeqadnmcfmapayasepksrlakmlvdvadpdfyqrvfftnggadsnen
aikmarmvtgrpkifscyrsyhgstigasnasgdwrrfatelggsapgfvhfmnpnmyed
gytrgvddatvtadylhrldeqlqyegpdsvaailmesivgangvilppegymegvralc
dkygilmicdevmagfgrtgkmfawqnfdvkpdmftfakgvtcgyvplggvvvskrisdy
ftdhvlqcgltysghtlacaagvaavnyylehdvcahvkemegilkpflesmvekhkcvg
earciglfsaltivknketrelmapyhtpnsvmpqimaklmdlgfstfgretninicppl
iitaeqleeelpkldkvltwvdenlc

SCOPe Domain Coordinates for d6jixb_:

Click to download the PDB-style file with coordinates for d6jixb_.
(The format of our PDB-style files is described here.)

Timeline for d6jixb_: