Lineage for d6gwpa_ (6gwp A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568351Protein automated matches [190484] (2 species)
    not a true protein
  7. 2568352Species Human (Homo sapiens) [TaxId:9606] [188559] (24 PDB entries)
  8. 3078661Domain d6gwpa_: 6gwp A: [378723]
    Other proteins in same PDB: d6gwpb_, d6gwpc_
    automated match to d1lj5a_

Details for d6gwpa_

PDB Entry: 6gwp (more details), 2.28 Å

PDB Description: crystal structure of stabilized active plasminogen activator inhibitor-1 (pai-1-stab) in complex with two inhibitory nanobodies (vhh-2g-42, vhh-2w-64)
PDB Compounds: (A:) plasminogen activator inhibitor-1

SCOPe Domain Sequences for d6gwpa_:

Sequence, based on SEQRES records: (download)

>d6gwpa_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
fseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssth
rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrpfqad
ftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhn
ptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d6gwpa_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
fseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssth
rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrpfqad
ftslsdqeplhvalalqkvkievnesgtavivsarmapeeiiidrpflfvvrhnptgtvl
fmgqvmep

SCOPe Domain Coordinates for d6gwpa_:

Click to download the PDB-style file with coordinates for d6gwpa_.
(The format of our PDB-style files is described here.)

Timeline for d6gwpa_:

  • d6gwpa_ is new in SCOPe 2.07-stable