Lineage for d6gwpb_ (6gwp B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Vicugna pacos [TaxId:30538] [189756] (80 PDB entries)
  8. Domain d6gwpb_: 6gwp B: [378722]
    Other proteins in same PDB: d6gwpa_
    automated match to d1ol0a_

Details for d6gwpb_

PDB Entry: 6gwp (more details), 2.2800000000000002 Å

PDB Description: crystal structure of stabilized active plasminogen activator inhibitor-1 (pai-1-stab) in complex with two inhibitory nanobodies (vhh-2g-42, vhh-2w-64)
PDB Compounds: (B:) VHH-2g-42

SCOPe Domain Sequences for d6gwpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwpb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqpggrlrlscaasgftfrtyamqwyrqspgterelvaaisniggvtdy
gdsvkgrftisrdnakttvylemnslkpedtatyycsavrlpqrywgrgtqvtvs

SCOPe Domain Coordinates for d6gwpb_ are not available.

Timeline for d6gwpb_:

Domains from other chains:
(mouse over for more information)
d6gwpa_, d6gwpc_