SCOPe 2.07: Domain d6j1qb_: 6j1q B:

Lineage for d6j1qb_ (6j1q B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)

6. Protein automated matches [190510] (9 species)
   not a true protein

7. Species Pseudozyma antarctica [TaxId:84753] [371852] (8 PDB entries)

8. Domain d6j1qb_: 6j1q B: [378698]
   Other proteins in same PDB: d6j1qa2
   automated match to d5a6va_
   complexed with 1pe, cl, edo, epe, peg, so4; mutant

Details for d6j1qb_

PDB Entry: 6j1q, 1.6 Å

PDB Description: crystal structure of candida antarctica lipase b mutant - rs

PDB Compounds: (B:) lipase b

SCOPe Domain Sequences for d6j1qb_:

Sequence; same for both SEQRES and ATOM records:

>d6j1qb_ c.69.1.17 (B:) automated matches {Pseudozyma antarctica [TaxId: 84753]}
lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaqlg
ytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltasqgglvaqwgltffps
irskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivptt
nlysatdevvqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrsa
lrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmpy
arpfavgkrtcsgivtp

Timeline for d6j1qb_:

• d6j1qb_ is new in SCOPe 2.07-stable
  
• d6j1qb_ appears in the current release, SCOPe 2.08