Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Hirschia baltica [TaxId:582402] [378684] (2 PDB entries) |
Domain d6v70a_: 6v70 A: [378685] automated match to d5a87b_ complexed with cd, cl, edo, fmt |
PDB Entry: 6v70 (more details), 1.95 Å
SCOPe Domain Sequences for d6v70a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v70a_ d.157.1.0 (A:) automated matches {Hirschia baltica [TaxId: 582402]} kpvefvklgtgvwmhtgykvvppwgnirtngliiergdysvlvdtawndaqtaeivawak dtlqkpirasihthahsdkmggmdalhmlgvetfatdltnrlaierglmpaknvlnisei gsqiewegltilypggghsednivvnegvnnilfggcmirpgmttslgniddanlgywsk avenaanafpdsqivipshgkpagreilkntayitrp
Timeline for d6v70a_: