Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [328556] (5 PDB entries) |
Domain d6vbfa_: 6vbf A: [378680] automated match to d5dcla_ complexed with ca, cl |
PDB Entry: 6vbf (more details), 1.85 Å
SCOPe Domain Sequences for d6vbfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vbfa_ c.23.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]} klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrrt
Timeline for d6vbfa_: