SCOPe 2.07: Domain d6vbfa_: 6vbf A:

Lineage for d6vbfa_ (6vbf A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (84 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [328556] (5 PDB entries)

8. Domain d6vbfa_: 6vbf A: [378680]
   automated match to d5dcla_
   complexed with ca, cl

Details for d6vbfa_

PDB Entry: 6vbf, 1.85 Å

PDB Description: 1.85 angstrom resolution crystal structure of n-terminal domain of two-component system response regulator from acinetobacter baumannii

PDB Compounds: (A:) Two-component regulatory system response regulator

SCOPe Domain Sequences for d6vbfa_:

Sequence; same for both SEQRES and ATOM records:

>d6vbfa_ c.23.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrrt

Timeline for d6vbfa_:

• d6vbfa_ is new in SCOPe 2.07-stable
  
• d6vbfa_ appears in the current release, SCOPe 2.08