Lineage for d6vbfa_ (6vbf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855813Species Acinetobacter baumannii [TaxId:470] [328556] (5 PDB entries)
  8. 2855818Domain d6vbfa_: 6vbf A: [378680]
    automated match to d5dcla_
    complexed with ca, cl

Details for d6vbfa_

PDB Entry: 6vbf (more details), 1.85 Å

PDB Description: 1.85 angstrom resolution crystal structure of n-terminal domain of two-component system response regulator from acinetobacter baumannii
PDB Compounds: (A:) Two-component regulatory system response regulator

SCOPe Domain Sequences for d6vbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vbfa_ c.23.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrrt

SCOPe Domain Coordinates for d6vbfa_:

Click to download the PDB-style file with coordinates for d6vbfa_.
(The format of our PDB-style files is described here.)

Timeline for d6vbfa_: