SCOP 1.57: Domain d1cc2a2: 1cc2 A:319-450

Lineage for d1cc2a2 (1cc2 A:319-450)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)

5. Family d.16.1.1: Cholesterol oxidase [54374] (1 protein)

6. Protein Cholesterol oxidase [54375] (2 species)

7. Species Streptomyces sp. [TaxId:1931] [54377] (4 PDB entries)

8. Domain d1cc2a2: 1cc2 A:319-450 [37868]
   Other proteins in same PDB: d1cc2a1

Details for d1cc2a2

PDB Entry: 1cc2, 2.2 Å

PDB Description: cholesterol oxidase from streptomyces his447gln mutant

SCOP Domain Sequences for d1cc2a2:

Sequence; same for both SEQRES and ATOM records:

>d1cc2a2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp.}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyqplg

Timeline for d1cc2a2:

• d1cc2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1cc2a2 appears in SCOP 1.59
  
• d1cc2a2 appears in the current release, SCOPe 2.08