Lineage for d6szpa_ (6szp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974297Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2974298Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2974447Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2974448Protein automated matches [190175] (10 species)
    not a true protein
  7. 2974468Species Human (Homo sapiens) [TaxId:9606] [187904] (35 PDB entries)
  8. 2974474Domain d6szpa_: 6szp A: [378669]
    automated match to d2jajb_
    complexed with gol, m3b

Details for d6szpa_

PDB Entry: 6szp (more details), 1.76 Å

PDB Description: high resolution crystal structure of human ddah-1 in complex with n- (4-aminobutyl)-n'-(2-methoxyethyl)guanidine
PDB Compounds: (A:) N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

SCOPe Domain Sequences for d6szpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6szpa_ d.126.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa
deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld
ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia
igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak
vyeklkdhmlipvsmselekvdglltccsvlinkk

SCOPe Domain Coordinates for d6szpa_:

Click to download the PDB-style file with coordinates for d6szpa_.
(The format of our PDB-style files is described here.)

Timeline for d6szpa_: