Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Lysobacter sp. [TaxId:186334] [346506] (3 PDB entries) |
Domain d6qoyc_: 6qoy C: [378653] automated match to d2ea3a_ complexed with aes, cl, gol, jat, peg, pge, so4 |
PDB Entry: 6qoy (more details), 1.9 Å
SCOPe Domain Sequences for d6qoyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qoyc_ b.47.1.0 (C:) automated matches {Lysobacter sp. [TaxId: 186334]} vnvlggieysinnatlcsvgfsvtrgatkgfvtaghcggvgaivriggtqvgsfaarvfp gndrawvsvgsahtlqgavsnysggtiairgsaeaaigaavcrsgrttgyrcgnitaknv tanyaegavrgltqgnacmgrgdsggswftsagqaqgvmsggnvqsngnncgipasqrss lfervgpilsqyglslvts
Timeline for d6qoyc_: