Lineage for d3coxa2 (3cox A:319-450)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161032Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2161033Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2161034Family d.16.1.1: GMC oxidoreductases [54374] (5 protein domains)
  6. 2161035Protein Cholesterol oxidase [54375] (3 species)
  7. 2161036Species Brevibacterium sterolicum [TaxId:1702] [54376] (2 PDB entries)
  8. 2161037Domain d3coxa2: 3cox A:319-450 [37863]
    Other proteins in same PDB: d3coxa1
    complexed with fad

Details for d3coxa2

PDB Entry: 3cox (more details), 1.8 Å

PDB Description: crystal structure of cholesterol oxidase complexed with a steroid substrate. implications for fad dependent alcohol oxidases
PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d3coxa2:

Sequence, based on SEQRES records: (download)

>d3coxa2 d.16.1.1 (A:319-450) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]}
gnngnimvgranhmwdatgskqatiptmgidnwadptapifaeiaplpagletyvslyla
itknperarfqfnsgtgkvdltwaqsqnqkgidmakkvfdkinqkegtiyrtdlfgvyyk
twgddftyhplg

Sequence, based on observed residues (ATOM records): (download)

>d3coxa2 d.16.1.1 (A:319-450) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]}
gnngnimvgranhmwdatgskqatiptmgidnwadptapifaeiaplpagletyvslyla
itknperarfqfnsgtgkvdltwaqsqnqkgidmakkvfdkinqkegtiyrtdlfyyktw
gddftyhplg

SCOPe Domain Coordinates for d3coxa2:

Click to download the PDB-style file with coordinates for d3coxa2.
(The format of our PDB-style files is described here.)

Timeline for d3coxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3coxa1