Lineage for d6p59e_ (6p59 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945540Protein Elongin C [54699] (3 species)
  7. 2945543Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)
  8. 2945721Domain d6p59e_: 6p59 E: [378613]
    Other proteins in same PDB: d6p59d_, d6p59w_
    automated match to d1vcbb_
    complexed with gol, mes, zn

Details for d6p59e_

PDB Entry: 6p59 (more details), 2.94 Å

PDB Description: crystal structure of sivrcm vif-cbfbeta-elob-eloc complex
PDB Compounds: (E:) Elongin-C

SCOPe Domain Sequences for d6p59e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p59e_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d6p59e_:

Click to download the PDB-style file with coordinates for d6p59e_.
(The format of our PDB-style files is described here.)

Timeline for d6p59e_: