![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein Elongin C [54699] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
![]() | Domain d6p59z_: 6p59 Z: [378611] Other proteins in same PDB: d6p59d_, d6p59w_ automated match to d1vcbb_ complexed with gol, mes, zn |
PDB Entry: 6p59 (more details), 2.94 Å
SCOPe Domain Sequences for d6p59z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p59z_ d.42.1.1 (Z:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
Timeline for d6p59z_: