Lineage for d6n6pa3 (6n6p A:210-574)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918429Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 2918430Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
    automatically mapped to Pfam PF02906
  5. 2918431Family c.96.1.1: Fe-only hydrogenase [53921] (3 proteins)
  6. 2918436Protein Fe-only hydrogenase, catalytic domain [53922] (1 species)
    includes C-terminal region homologous to the smaller subunit of Desulfovidrio hydrogenase
  7. 2918437Species Clostridium pasteurianum [TaxId:1501] [53923] (7 PDB entries)
  8. 2918444Domain d6n6pa3: 6n6p A:210-574 [378577]
    Other proteins in same PDB: d6n6pa1, d6n6pa2
    automated match to d1feha1
    complexed with 402, fes, gol, sf4

Details for d6n6pa3

PDB Entry: 6n6p (more details), 1.95 Å

PDB Description: crystal structure of [fefe]-hydrogenase in the presence of 7 mm sodium dithionite
PDB Compounds: (A:) Iron hydrogenase 1

SCOPe Domain Sequences for d6n6pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n6pa3 c.96.1.1 (A:210-574) Fe-only hydrogenase, catalytic domain {Clostridium pasteurianum [TaxId: 1501]}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykk

SCOPe Domain Coordinates for d6n6pa3:

Click to download the PDB-style file with coordinates for d6n6pa3.
(The format of our PDB-style files is described here.)

Timeline for d6n6pa3: