SCOPe 2.08: Domain d6kvmb2: 6kvm B:93-190

Lineage for d6kvmb2 (6kvm B:93-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)

8. Domain d6kvmb2: 6kvm B:93-190 [378564]
   Other proteins in same PDB: d6kvma1, d6kvmb1
   automated match to d1bx2b1
   complexed with gol

Details for d6kvmb2

PDB Entry: 6kvm, 1.9 Å

PDB Description: crystal structure of chicken mhc class ii for 1.9 angstrom

PDB Compounds: (B:) MHC class II beta chain 2

SCOPe Domain Sequences for d6kvmb2:

Sequence, based on SEQRES records:

>d6kvmb2 b.1.1.0 (B:93-190) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rsvepkvrvsalqsgslpetdrlacyvtgfyppeievkwflngreetervvstdvmqngd
wtyqvlvvletvprrgdsyvcrvehaslrqpisqawep

Sequence, based on observed residues (ATOM records):

>d6kvmb2 b.1.1.0 (B:93-190) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rsvepkvrvsarlacyvtgfyppeievkwflngreetervvstdvmqngdwtyqvlvvle
tvprrgdsyvcrvehaslrqpisqawep

Timeline for d6kvmb2:

• d6kvmb2 first appeared in SCOPe 2.07