SCOPe 2.08: Domain d6kvma1: 6kvm A:1-84

Lineage for d6kvma1 (6kvm A:1-84)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries)

8. Domain d6kvma1: 6kvm A:1-84 [378561]
   Other proteins in same PDB: d6kvma2, d6kvmb2
   automated match to d1fnga2
   complexed with gol

Details for d6kvma1

PDB Entry: 6kvm, 1.9 Å

PDB Description: crystal structure of chicken mhc class ii for 1.9 angstrom

PDB Compounds: (A:) MHC class II alpha chain

SCOPe Domain Sequences for d6kvma1:

Sequence; same for both SEQRES and ATOM records:

>d6kvma1 d.19.1.0 (A:1-84) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lkphvllqaefyqrsegpdkawaqfgfhfdadelfhveldaaqtvwrlpefgrfasfeaq
galqnmavgkqnlevmisnsnrsq

Timeline for d6kvma1:

• d6kvma1 first appeared in SCOPe 2.07