SCOPe 2.08: Domain d6izcb_: 6izc B:

Lineage for d6izcb_ (6izc B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Vibrio parahaemolyticus [TaxId:670] [378548] (2 PDB entries)

8. Domain d6izcb_: 6izc B: [378553]
   automated match to d3w4pa_
   complexed with 1pe, so4

Details for d6izcb_

PDB Entry: 6izc, 1.55 Å

PDB Description: crystal structure of the chromosome-encoded beta-lactamase of vibrio parahaemolyticus

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6izcb_:

Sequence; same for both SEQRES and ATOM records:

>d6izcb_ e.3.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
klnedisliekqtsgrigvsvwdtqtderwdyrgderfplmstfktlacatmlsdmdsgk
lnknataridernivvwspvmdklagqstriehaceaamlmsdntaanlvlneiggpkav
tlflrsigdkatrldrleprlneakpgdkrdtttpnamvntlhtlmednalsyesrtqlk
iwmqdnkvsdslmrsvlpkgwsiadrsgagnygsrgisamiwkdnykpvyisiyvtdtdl
slqardqliaqisqlilehykes

Timeline for d6izcb_:

• d6izcb_ first appeared in SCOPe 2.07