Lineage for d6izcb_ (6izc B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3015068Species Vibrio parahaemolyticus [TaxId:670] [378548] (2 PDB entries)
  8. 3015070Domain d6izcb_: 6izc B: [378553]
    automated match to d3w4pa_
    complexed with 1pe, so4

Details for d6izcb_

PDB Entry: 6izc (more details), 1.55 Å

PDB Description: crystal structure of the chromosome-encoded beta-lactamase of vibrio parahaemolyticus
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6izcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6izcb_ e.3.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
klnedisliekqtsgrigvsvwdtqtderwdyrgderfplmstfktlacatmlsdmdsgk
lnknataridernivvwspvmdklagqstriehaceaamlmsdntaanlvlneiggpkav
tlflrsigdkatrldrleprlneakpgdkrdtttpnamvntlhtlmednalsyesrtqlk
iwmqdnkvsdslmrsvlpkgwsiadrsgagnygsrgisamiwkdnykpvyisiyvtdtdl
slqardqliaqisqlilehykes

SCOPe Domain Coordinates for d6izcb_:

Click to download the PDB-style file with coordinates for d6izcb_.
(The format of our PDB-style files is described here.)

Timeline for d6izcb_: