SCOPe 2.08: Domain d6j62a2: 6j62 A:77-151

Lineage for d6j62a2 (6j62 A:77-151)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)

8. Domain d6j62a2: 6j62 A:77-151 [378552]
   Other proteins in same PDB: d6j62c_
   automated match to d5chvc2

Details for d6j62a2

PDB Entry: 6j62, 2.49 Å

PDB Description: crystal structure of misg15/ns1b complex

PDB Compounds: (A:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d6j62a2:

Sequence; same for both SEQRES and ATOM records:

>d6j62a2 d.15.1.0 (A:77-151) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
seplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellg
eyglkpqctvikhlr

Timeline for d6j62a2:

• d6j62a2 first appeared in SCOPe 2.07