Lineage for d6j62c_ (6j62 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311087Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2311088Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (3 species)
  7. 2311093Species Influenza b virus (strain b/lee/1940) [TaxId:518987] [375439] (2 PDB entries)
  8. 2311096Domain d6j62c_: 6j62 C: [378550]
    Other proteins in same PDB: d6j62a1, d6j62a2
    automated match to d1xeqa1

Details for d6j62c_

PDB Entry: 6j62 (more details), 2.49 Å

PDB Description: crystal structure of misg15/ns1b complex
PDB Compounds: (C:) Non-structural protein 1

SCOPe Domain Sequences for d6j62c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j62c_ a.16.1.1 (C:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza b virus (strain b/lee/1940) [TaxId: 518987]}
qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
nkrmsleerkaigvkmmkvllfmdpsagiegf

SCOPe Domain Coordinates for d6j62c_:

Click to download the PDB-style file with coordinates for d6j62c_.
(The format of our PDB-style files is described here.)

Timeline for d6j62c_: