![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
![]() | Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries) |
![]() | Domain d2glse1: 2gls E:1-100 [37855] Other proteins in same PDB: d2glsa2, d2glsb2, d2glsc2, d2glsd2, d2glse2, d2glsf2, d2glsg2, d2glsh2, d2glsi2, d2glsj2, d2glsk2, d2glsl2 complexed with mn |
PDB Entry: 2gls (more details), 3.5 Å
SCOPe Domain Sequences for d2glse1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glse1 d.15.9.1 (E:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi nesdmvlmpdastavidpffadstliircdilepgtlqgy
Timeline for d2glse1: