Lineage for d6izda_ (6izd A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3015068Species Vibrio parahaemolyticus [TaxId:670] [378548] (2 PDB entries)
  8. 3015071Domain d6izda_: 6izd A: [378549]
    automated match to d3w4pa_
    complexed with gol; mutant

Details for d6izda_

PDB Entry: 6izd (more details), 1.6 Å

PDB Description: crystal structure of the chromosome-encoded beta-lactamase mutant r168h/m221i of vibrio parahaemolyticus
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6izda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6izda_ e.3.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
klnedisliekqtsgrigvsvwdtqtderwdyrgderfplmstfktlacatmlsdmdsgk
lnknataridernivvwspvmdklagqstriehaceaamlmsdntaanlvlneiggpkav
tlflrsigdkatrldrlephlneakpgdkrdtttpnamvntlhtlmednalsyesrtqlk
iwmqdnkvsdslirsvlpkgwsiadrsgagnygsrgisamiwkdnykpvyisiyvtdtdl
slqardqliaqisqlilehy

SCOPe Domain Coordinates for d6izda_:

Click to download the PDB-style file with coordinates for d6izda_.
(The format of our PDB-style files is described here.)

Timeline for d6izda_: