Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Vibrio parahaemolyticus [TaxId:670] [378548] (2 PDB entries) |
Domain d6izda_: 6izd A: [378549] automated match to d3w4pa_ complexed with gol; mutant |
PDB Entry: 6izd (more details), 1.6 Å
SCOPe Domain Sequences for d6izda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6izda_ e.3.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 670]} klnedisliekqtsgrigvsvwdtqtderwdyrgderfplmstfktlacatmlsdmdsgk lnknataridernivvwspvmdklagqstriehaceaamlmsdntaanlvlneiggpkav tlflrsigdkatrldrlephlneakpgdkrdtttpnamvntlhtlmednalsyesrtqlk iwmqdnkvsdslirsvlpkgwsiadrsgagnygsrgisamiwkdnykpvyisiyvtdtdl slqardqliaqisqlilehy
Timeline for d6izda_: