SCOPe 2.07: Domain d6igia_: 6igi A:

Lineage for d6igia_ (6igi A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.0: automated matches [191496] (1 protein)
   not a true family

6. Protein automated matches [190806] (3 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188075] (5 PDB entries)

8. Domain d6igia_: 6igi A: [378539]
   automated match to d1wkpa_
   complexed with edo

Details for d6igia_

PDB Entry: 6igi, 1.33 Å

PDB Description: crystal structure of ft condition 2

PDB Compounds: (A:) Protein FLOWERING LOCUS T

SCOPe Domain Sequences for d6igia_:

Sequence; same for both SEQRES and ATOM records:

>d6igia_ b.17.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dplivsrvvgdvldpfnrsitlkvtygqrevtngldlrpsqvqnkprveiggedlrnfyt
lvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagihrvvfilfr
qlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqres

Timeline for d6igia_:

• d6igia_ is new in SCOPe 2.07-stable
  
• d6igia_ appears in the current release, SCOPe 2.08