Lineage for d6adlc_ (6adl C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. Protein automated matches [190988] (49 species)
    not a true protein
  7. Species Senecavirus a [TaxId:390157] [378534] (1 PDB entry)
  8. Domain d6adlc_: 6adl C: [378536]
    Other proteins in same PDB: d6adlr1, d6adlr2
    automated match to d3cjib_
    complexed with mg

Details for d6adlc_

PDB Entry: 6adl (more details), 3.08 Å

PDB Description: anthrax toxin receptor 1-bound spent particles of seneca valley virus in acidic conditions
PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d6adlc_:

Sequence, based on SEQRES records: (download)

>d6adlc_ b.121.4.0 (C:) automated matches {Senecavirus a [TaxId: 390157]}
gpiptaprenslmflsttpddtvpaygnvrtppvnylpgeitdllqlariptlmafgrvp
epepasdayvpyvavptqfddkplisfpitlsdpvyqntlvgaissnfanyrgciqitlt
fcgpmmargkfllsysppngtqpqtlseamqctysiwdiglnsswtfvipyispsdyret
raitnsvysadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf

Sequence, based on observed residues (ATOM records): (download)

>d6adlc_ b.121.4.0 (C:) automated matches {Senecavirus a [TaxId: 390157]}
gpiptaprenslmflsttpddtvpaygnvrtppvnylpgeitdllqlariptlmafgrda
yvpyvavptqfddkplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmmar
gkfllsysppngtqpqtlseamqctysiwdiglnsswtfvipyispsdyretraitnsvy
sadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf

SCOPe Domain Coordinates for d6adlc_ are not available.

Timeline for d6adlc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6adlr1, d6adlr2