SCOPe 2.08: Domain d6adlr1: 6adl R:38-220

Lineage for d6adlr1 (6adl R:38-220)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein automated matches [190060] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries)

8. Domain d6adlr1: 6adl R:38-220 [378535]
   Other proteins in same PDB: d6adlc_, d6adlr2
   automated match to d1shux_
   complexed with mg

Details for d6adlr1

PDB Entry: 6adl, 3.08 Å

PDB Description: anthrax toxin receptor 1-bound spent particles of seneca valley virus in acidic conditions

PDB Compounds: (R:) Anthrax toxin receptor 1

SCOPe Domain Sequences for d6adlr1:

Sequence; same for both SEQRES and ATOM records:

>d6adlr1 c.62.1.1 (R:38-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmklte
dreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhedl
ffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsilk
ksc

Timeline for d6adlr1:

• d6adlr1 first appeared in SCOPe 2.07