Lineage for d6u3md1 (6u3m D:3-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938688Domain d6u3md1: 6u3m D:3-92 [378530]
    Other proteins in same PDB: d6u3ma2, d6u3mb2, d6u3mc2, d6u3md2
    automated match to d1klub2
    complexed with gol, nag, po4

Details for d6u3md1

PDB Entry: 6u3m (more details), 1.9 Å

PDB Description: dq2-p.fluor-alpha1a
PDB Compounds: (D:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d6u3md1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u3md1 d.19.1.0 (D:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq

SCOPe Domain Coordinates for d6u3md1:

Click to download the PDB-style file with coordinates for d6u3md1.
(The format of our PDB-style files is described here.)

Timeline for d6u3md1: