Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d6u3md1: 6u3m D:3-92 [378530] Other proteins in same PDB: d6u3ma2, d6u3mb2, d6u3mc2, d6u3md2 automated match to d1klub2 complexed with gol, nag, po4 |
PDB Entry: 6u3m (more details), 1.9 Å
SCOPe Domain Sequences for d6u3md1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u3md1 d.19.1.0 (D:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn sqkdilerkraavdrvcrhnyqlelrttlq
Timeline for d6u3md1: